Suche zurücksetzen

Inhalte

  • Frauen und Gleichstellungspolitik

Akteure

  • Schweizerischer Gewerkschaftsbund (SGB)

Prozesse

24 Resultate
Als PDF speichern Weitere Informationen zur Suche finden Sie hier

Jahresrückblick 2023: Verbände

Zu den bedeutsamsten Ereignissen des Jahres 2023 gehörten für viele Verbände die eidgenössischen Wahlen. Wohl am meisten Präsenz hatten dabei Economiesuisse, Arbeitgeber-, Gewerbe- und Bauernverband, die erhebliche Mittel in ihre gemeinsame Wahlkampagne «Perspektive Schweiz» investierten, welche zu einem (land)wirtschaftsfreundlich zusammengesetzten Parlament beitragen sollte. Dabei wurde insbesondere von links-grüner Seite, aber auch in Medienkommentaren und von vereinzelten Bürgerlichen darauf verwiesen, dass der SBV und die grossen Wirtschaftsverbände namentlich in den Themen Freihandel und Subventionen grundlegend andere Interessen hätten, die mit der Zusammenarbeit nur notdürftig zugedeckt und früher oder später aufbrechen würden. In den Medien wurde denn auch unterschiedlich eingeschätzt, inwieweit der Rechtsruck im Nationalrat tatsächlich im Sinn der grossen Wirtschaftsverbände sei, da er vor allem durch Gewinne der SVP zustandekam, die in europa- und migrationspolitischer Hinsicht oft andere Positionen vertritt als etwa Economiesuisse. Einig war sich die Presse indessen, dass der Bauernverband gestärkt aus den Wahlen hervorging. Vor allem im Zusammenhang mit den Wahlen konnte dieser gegenüber den Vorjahren auch seine Medienpräsenz deutlich steigern (siehe Abbildung 2 der APS-Zeitungsanalyse).

Mit Vorwürfen sah sich im Wahlkampf der Gewerkschaftsbund (SGB) konfrontiert, weil er den Organisationsaufwand für eine grosse Kaufkraftdemonstration kurz vor den Wahlen nicht als Wahlkampfkosten gemäss der neuen Transparenzgesetzgebung zur Politikfinanzierung deklariert hatte. Der SGB legte sein Budget für die Demonstration daraufhin rasch offen, stellte sich aber auf den Standpunkt, es habe sich nicht um eine Wahlkampfveranstaltung gehandelt. Scharfe Kritik handelte sich sodann die Kampagnenorganisation Campax ein, als sie im Wahlkampf einen Aufkleber verbreitete, auf dem die SVP und die FDP mehr oder weniger explizit als «Nazis» bezeichnet wurden. Campax änderte das Sujet daraufhin ab, doch der Vorfall führte zu erneuten bürgerlichen Forderungen, die Regeln für politische Kampagnenaktivitäten von staatlich unterstützten NGOs zu verschärfen.

Mehrere Verbände mussten sich im Berichtsjahr mit bedeutenden internen Konflikten auseinandersetzen. Im Schweizer Tierschutz (STS) eskalierten Diskussionen um Spesenabrechnungen und Führungsstil zu einem heftigen Machtkampf zwischen der Präsidentin und einem Teil der übrigen Vorstandsmitglieder. Stärker politisch aufgeladen war ein Machtkampf zwischen konservativen und progressiven Kräften in der Schweizerischen Gemeinnützigen Gesellschaft (SGG), in dessen Zug der Vorstand alle Neueintritte bis 2024 sistierte, um einen befürchteten «Putsch» an der Mitgliederversammlung zu verhindern. Auch beim Konsumentenforum entbrannte ein Konflikt mit stark politischer Note, indem ein Vereinsmitglied der Verbandsspitze vorwarf, auf Kosten der Konsumentinnen- und Konsumenten-Interessen eine Kaperung der Organisation, insbesondere durch Wirtschaftsverbände, zu orchestrieren. Beim Hauseigentümerverband (HEV) war dessen Nein-Kampagne zum Klimagesetz Auslöser für interne Auseinandersetzungen und zahlreiche, teilweise prominente Verbandsaustritte. Zu einer Zerreissprobe kam es sodann bei der Frauen-Dachorganisation Alliance F, als deren Spitze sich im März im Parlament zugunsten der BVG-Reform einsetzte. Als Reaktion sistierten die SP Frauen zunächst ihre Verbandsmitgliedschaft und prüften unter anderem den Aufbau einer neuen, linken Frauen-Dachorganisation. Schliesslich entschieden sie jedoch, unter bestimmten Bedingungen vorerst doch bei Alliance F zu bleiben.

Beim Gewerbeverband (SGV) fielen Auseinandersetzungen um die politische Ausrichtung des Verbands derweil mit einem Personalgeschäft zusammen, das dem Verband deutlich mehr mediale Aufmerksamkeit bescherte als in den Vorjahren (siehe Abbildung 2): Als Nachfolger des langjährigen Verbandsdirektors Hans-Ulrich Bigler wurde zunächst Henrique Schneider gewählt, aufgrund einer Plagiatsaffäre wurde Schneiders Wahl jedoch noch vor dessen Amtsantritt widerrufen. So wählte der SGV mit Urs Furrer letztlich einen Verbandsdirektor, von dem die Medien einen moderateren Kurs erwarteten als von Bigler und Schneider. Reibungsloser ging die Neubesetzung von Spitzenposten in einer Reihe anderer Verbände über die Bühne, so beim Arbeitgeberverband, bei der Syna, beim VPOD, beim Versicherungsverband, bei Curafutura, bei der Bankiervereinigung, bei Avenir Suisse und bei Auto Schweiz.

Grössere strukturelle Veränderungen gab es in der Schweizer Verbandslandschaft 2023 kaum. Mit «Cinéconomie» wurde eine neue Allianz von Interessenorganisationen der Filmwirtschaft gegründet. Die Bankiervereinigung konnte die Rückkehr von Raiffeisen in den Verband verzeichnen, wohingegen der Krankenkassenverband Curafutura den Austritt der KPT hinnehmen musste.

Mediale Aufmerksamkeit für eigene inhaltliche Forderungen erzielte der Arbeitgeberverband mit einem Papier zum Fachkräftemangel, in dem er unter anderem längere und flexiblere Arbeitszeiten forderte, was starke Kritik von den Gewerkschaften provozierte. Der Mieterinnen- und Mieterverband forderte in der Diskussion um die steigenden Mieten insbesondere staatliche Mietzinskontrollen gegen missbräuchliche Mieten und deutlich mehr gemeinnützigen Wohnungsbau. Auch verschiedene Gruppierungen der Klimabewegung versuchten, Aufmerksamkeit für ihre Anliegen zu generieren, wobei sie wie in den Vorjahren wiederum zu teilweise umstrittenen Aktionsformen griffen.

Jahresrückblick 2023: Verbände
Dossier: Jahresrückblick 2023

Ende März veröffentlichte die SPK-SR den Bericht zur Vernehmlassung der Umsetzung der vier Standesinitiativen (ZG: 19.311, BL: 20.313, LU: 20.323, BS: 21.311), die eine bessere Vereinbarkeit von Mutterschaft und Parlamentsmandat verlangen. Konkret sollen Frauen nach der Geburt eines Kindes ihre Mutterschaftsentschädigung nicht mehr verlieren, wenn sie ein politisches Legislativmandat wahrnehmen. Aktuell erlischt der Anspruch, wenn eine Erwerbstätigkeit wieder aufgenommen wird, wozu auch die Arbeit als Parlamentarierin gezählt wird. Dies führt dazu, dass gewählte Parlamentarierinnen entweder nicht an Sitzungen teilnehmen oder aber den Auftrag der Wählenden wahrnehmen, dadurch aber auf ihre Entschädigung verzichten müssen. Dies soll mit einer Revision des Erwerbsersatzgesetzes geändert werden. Die Vorlage sieht vor, dass eine Teilnahme an Plenar- oder Kommissionssitzungen auf allen drei föderalen Ebenen durch eine Frau – Männer bzw. Vaterschaftsurlaubsregelungen wurden explizit ausgenommen – deren Anspruch auf Mutterschaftsentschädigung nicht mehr beeinträchtigt, es sei denn, es bestehe eine Stellvertretungslösung.

Die Mehrheit der 53 eingegangenen Stellungnahmen in der Vernehmlassung unterstützten den Umsetzungsvorschlag. Von den 25 antwortenden Kantonen (GR hatte auf eine Stellungnahme verzichtet), sprachen sich 18 dafür aus, Aargau, Nidwalden und Genf wollten die Einschränkung durch die Stellvertreterlösungen streichen und Solothurn wollte nicht bloss Plenar- und Kommissionssitzungen, sondern sämtliche mit einem Mandat verbundenen Tätigkeiten aufführen. Gegen die Vorlage stellten sich Appenzell Ausserrhoden, Thurgau und Schwyz, die eine Aufweichung des Mutterschutzes befürchteten: Die Regelung könnte dazu führen, dass sich Mütter mit einem politischen Mandat verpflichtet fühlten, ihren Mutterschaftsurlaub zu unterbrechen, so die Begründung. EVP, FDP, GLP, GP, Mitte und SP begrüssten die geplante Umsetzung, die SVP lehnte sie ab, weil sie eine Besserbehandlung von Politikerinnen gegenüber anderen berufstätigen Frauen bedeute. Umstritten war die Vorlage bei den Verbänden. Bei den Gewerkschaften begrüsste der SGB die Vorlage grundsätzlich, warnte aber vor weiteren Lockerungen; Travail.Suisse stellte sich gegen jegliche Lockerung des Mutterschutzes und lehnte die Vorlage ab. Die Arbeitgeberverbände (SAV und SGV) kritisierten die Ungleichbehandlung und forderten eine Lockerung der Kriterien für Mutterschaftsurlaub für alle Frauen, standen der Vorlage also eher ablehnend entgegen. Verschiedene Frauenverbände (AllianceF, SKG und SVF) begrüssten die Vorlage zwar, verlangten aber weitere Flexibilisierungen hinsichtlich zeitlicher Gestaltung des Mutterschaftsurlaubs generell und einen Verzicht auf die Ausnahme hinsichtlich Stellvertretungsregelung. Es könne bei Kommissionssitzungen, die häufig Stellvertretungsregelungen kennen, wichtig sein, persönlich anwesend zu sein.
Die SPK-SR beschloss aufgrund der Vernehmlassungsresultate, an der ursprünglichen Lösung festzuhalten und lediglich die Teilnahme an Kommissions- und Plenarsitzungen zu regeln, im Falle von möglichen Stellvertretungslösungen aber keine Ausnahmen zu machen. Die Vorlage geht in die parlamentarische Beratung.

Mutterschaft und Parlamentsmandat (Kt.Iv. 19.311, Kt.Iv.20.313, Kt.Iv.20.323 und Kt.Iv.21.311)
Dossier: Frauenanteil im Parlament
Dossier: Vereinbarkeit der Parlamentsarbeit mit Familie und Beruf

Im Dezember 2022 präsentierte die WBK-NR ihren Entwurf zur Überführung der Anstossfinanzierung der ausserfamiliären Kinderbetreuung in eine zeitgemässe Lösung, der sich in nicht unwesentlichen Punkten vom zuvor in die Vernehmlassung geschickten Vorentwurf unterschied.
Insgesamt 275 Stellungnahmen waren in der Vernehmlassung eingegangen, die grosse Mehrheit davon fiel positiv aus. So unterstützten 23 Kantone den Vorentwurf, ebenso wie acht von zehn stellungnehmenden Wirtschaftsverbänden – darunter GastroSuisse, SGB und Travail.Suisse – und acht Parteien – darunter die SP, die Grünen, die GLP und die Mitte. Abgelehnt wurde die Vorlage von der SVP und der FDP; die FDP-Frauen sprachen sich hingegen für den Vorentwurf aus. Bei den Wirtschaftsverbänden äusserte economiesuisse trotz Unterstützung der Vorlage erhebliche Vorbehalte, während sich der SGV gänzlich ablehnend zur Vorlage positionierte. Die Befürwortenden begrüssten grundsätzlich, dass das seit 2003 bestehende Impulsprogramm in eine dauerhafte Lösung überführt werden soll, ebenso wie das stärkere Engagement durch den Bund. Ferner vertraten sie die Ansicht, die Vorlage verbessere die Vereinbarkeit zwischen Familie und Beruf, wirke dem Fachkräftemangel entgegen und fördere die Chancengerechtigkeit für Kinder im Vorschulalter. Die gegnerischen Stimmen, darunter die drei ablehnenden Kantone Bern, Graubünden und Zug, sahen durch den Vorentwurf die Kompetenzverteilung zwischen dem Bund und den Kantonen verletzt. In eine ähnliche Stossrichtung gingen die Bedenken des SGV sowie der SVP und der FDP. Anders beurteilten dies die meisten Kantone und die SODK, ebenso wie die für den Vorentwurf zuständige WBK-NR, die die neue Rolle des Bundes nicht nur mit Rückgriff auf die in Art. 116 Abs. 1 BV erwähnte Unterstützungskompetenz, sondern darüber hinaus mit Bezug auf Art. 110 Abs. 1 Bst. a BV (Arbeitnehmendenschutz) und Art. 8 Abs. 3 BV (Gleichstellung von Mann und Frau) legitimierte. Die SVP vertrat zusätzlich die Ansicht, dass die Vorlage die Wahlfreiheit der Eltern, die ihre Kinder nicht extern betreuen lassen wollen, einschränke. Economiesuisse und der SGV sorgten sich auch um die Kosten, insbesondere verbunden mit der offenen Frage der (Gegen-)Finanzierung.
Aufgrund der im Vernehmlassungsverfahren eingegangenen Rückmeldungen passte die WBK-NR ihren Entwurf im Vergleich zum Vorentwurf in zwei Punkten an. Erstens verlangte der Entwurf neu für jeden Kanton während der ersten vier Jahre eine Bundesbeteiligung von 20 Prozent an den durchschnittlichen Betreuungskosten der Eltern. Bei unzulänglichem finanziellen Engagement der Kantone könnte der Betrag daraufhin auf bis zu 10 Prozent der Betreuungskosten gekürzt werden. Im Vorentwurf hatte die Kommission eine umgekehrte Lösung vorgeschlagen, wonach der Bund zu Beginn einen Sockelbeitrag von 10 Prozent entrichtet hätte. Kantone mit vergleichsweise hohem finanziellen Engagement hätten in der Folge noch einen Zusatzbeitrag (+5% oder +10%) erhalten können. Die zweite Änderung im Vergleich zum Vorentwurf betraf die Höhe des Verpflichtungskredites zur Unterstützung von Programmen zur Schliessung der Angebotslücken in der familienexternen Betreuung. Während der Vorentwurf für die ersten vier Jahre hierfür insgesamt einen Betrag von CHF 160 Mio. bereitstellen wollte, wurde dieser Betrag im Entwurf auf CHF 240 Mio. erhöht. Dies, nachdem diverse Vernehmlassungsteilnehmende bemängelt hatten, dass zusätzliches Gewicht auf die Qualitätssicherung und -entwicklung gelegt werden sollte. Mit diesen Änderungen versehen genehmigte die Kommission den Entwurf in der Gesamtabstimmung mit 17 zu 7 Stimmen bei einer Enthaltung. Dass die Diskussion um die Vorlage damit noch lange nicht abgeschlossen sein würde, liessen bereits die zahlreichen Anträge diverser Kommissionsminderheiten erahnen, die die WBK-NR in ihrem Bericht und teilweise bereits in ihrer Medienmitteilung aufführte.

Überführung der Anstossfinanzierung in eine zeitgemässe Lösung (Pa.Iv. 21.403)
Dossier: Finanzhilfen zur Förderung familienergänzender Kinderbetreuung

Ende April 2022 kam das Referendum gegen die AHV21 zustande. Damit wurde an der Urne nicht nur über die Mehrwertsteuererhöhung um 0.4 Prozentpunkte respektive 0.1 Prozentpunkte und somit über eine Zusatzfinanzierung für die AHV von CHF 12.4 Mrd. bis 2032 abgestimmt – diese musste als Verfassungsänderung sowieso der Stimmbürgerschaft vorgelegt werden –, sondern auch über die übrigen Massnahmen des Reformprojekts. Dieses sah vor, das Rentenalter der Frauen in vier Schritten (2024 bis 2027) demjenigen der Männer anzupassen, wodurch die AHV bis 2032 CHF 9 Mrd. weniger ausgeben respektive mehr einnehmen sollte als bisher. Im Gegenzug sollten die ersten neun betroffenen Frauenjahrgänge Zuschläge zu ihren Renten oder günstigere Bedingungen beim Rentenvorbezug erhalten, die insgesamt CHF 2.8 Mrd. kosten sollten. Allgemein sollte der Start des Rentenbezugs flexibilisiert und neu zwischen 63 und 70 Jahren möglich werden – mit entsprechenden Abzügen und (teilweise) Gutschriften bei früherem oder späterem Bezug –, wobei die Rente nicht mehr nur vollständig, sondern auch teilweise bezogen werden kann. Dies würde bis 2032 etwa CHF 1.3 Mrd. kosten. Insgesamt könnten die AHV-Ausgaben bis ins Jahr 2032 um insgesamt CHF 4.9 Mrd. gesenkt werden.

Die Gegnerinnen und Gegner der AHV21-Reform wehrten sich vor allem gegen die Finanzierung der Reform auf dem «Buckel der Frauen» (Tages-Anzeiger), also durch die Erhöhung des Frauenrentenalters. Dadurch würde den Frauen faktisch die Rente gekürzt – ein Jahr weniger Rente entspreche CHF 26'000, rechnete das Referendumskomitee vor. Diese Reduktion würde noch nicht einmal für diejenigen Jahrgänge, welche Kompensationsmassnahmen erhielten, vollständig ausgeglichen. Besonders störend daran sei, dass Frauen noch immer einen deutlich geringeren Lohn für ihre Arbeit und einen Drittel weniger Rente als die Männer erhielten, während sie gleichzeitig sehr viel mehr unbezahlte Arbeit leisteten. Darüber hinaus erachtete die Gegnerschaft die Erhöhung des Frauenrentenalters auch als ersten Schritt hin zum Rentenalter 67, das sie jedoch unter anderem mit Verweis auf die schlechten Arbeitsmarktchancen älterer Arbeitnehmender sowie auf die Erhöhung der Langzeitarbeitslosigkeit und der Sozialhilfequote ablehnte. Schliesslich erachteten die Gegnerinnen und Gegner auch die aktuelle Situation der AHV als weniger gravierend als die Befürwortenden der Revision: Die AHV sei solide, werde aber immer durch dramatische Prognosen schlechtgeredet – diese seien bisher jedoch nie eingetroffen. Die Nein-Parole zu beiden AHV-Vorlagen gaben die SP, die Grünen, die PdA sowie die SD aus, sie wurden von den Gewerkschaften unterstützt.

Die Befürwortenden der Reform betonten, dass die AHV struktureller Reformen bedürfe, zumal sie ansonsten bereits in wenigen Jahren mehr ausgeben als einnehmen werde. Die AHV21-Reform führe durch Massnahmen sowohl auf Einnahmeseite – durch die Mehrwertsteuererhöhung – als auch auf Ausgabenseite – durch die Erhöhung des Frauenrentenalters – zu einer Verbesserung der AHV-Finanzen. Bezüglich des Arguments der Gegnerschaft, dass vor allem die Frauen für die Reform aufkommen müssten, verwiesen die Befürwortenden auf die «substanziellen Kompensationen», welche die Frauen der Übergangsgeneration erhielten. Zudem sei eine Rentenaltererhöhung der Frauen auf 65 Jahre gerechtfertigt, da sie einerseits als Teil der Gleichstellung erachtet werden könne und da die grossen Rentenunterschiede andererseits nicht aus der AHV, sondern aus der beruflichen Vorsorge stammten. Im Gegenzug forderten jedoch auch verschiedene Mitglieder der Pro-Komitees Verbesserungen für die Frauen in der zweiten Säule, vor allem beim Koordinationsabzug, welcher gesenkt werden sollte. Die Ja-Parole zu beiden Vorlagen gaben die SVP, die FDP, die Mitte, die GLP, die EVP und die EDU sowie etwa Economiesuisse, der Arbeitgeberverband, der Gewerbeverband und der Bauernverband aus.

In der medialen Berichterstattung stand vor allem die Frage nach den Auswirkungen für die Frauen sowie der Fairness ihnen gegenüber im Mittelpunkt. Im Zentrum des Interesses stand dabei der Bund Schweizerischer Frauenorganisationen, Alliance f. So zeigten sich die im Verband organisierten Frauen öffentlich gespalten: Selbst der Vorstand des Verbands bestand aus Befürworterinnen und Gegnerinnen der AHV21. Alliance f sei in einer «delikate[n] Ausgangslage», betonten folglich etwa die AZ-Medien. Als Konsequenz gab der Verband Stimmfreigabe heraus und schuf zwei Frauenallianzkomitees, ein befürwortendes und ein ablehnendes. Damit wolle man sich trotz unterschiedlicher Positionen in die Diskussion einbringen und somit verhindern, dass die Männer die Debatte um das Frauenrentenalter dominierten, betonte etwa Co-Präsidentin von Alliance f und Präsidentin des befürwortenden Frauen-Komitees, Kathrin Bertschy (glp, BE).

Zusätzliche Aufmerksamkeit erhielt die AHV21-Abstimmung Ende Mai, als das BSV die neuen Finanzperspektiven der AHV herausgab. So war der Bundesrat in der Botschaft zur AHV21 im August 2019 von einem negativen Betriebsergebnis der AHV im Jahr 2030 von CHF 4.6. Mrd. ausgegangen. Im Juni 2021 hatte das BSV für 2030 ein Defizit von CHF 3.7 Mrd. prognostiziert, in den neusten Finanzperspektiven Ende Mai 2022 war hingegen nur noch von einem Defizit von CHF 1.8 Mrd. die Rede. Das BSV erklärte diese Veränderungen mit dem guten Betriebsergebnis des AHV-Ausgleichsfonds 2021 sowie mit einem stärkeren Beschäftigungs- und Reallohnwachstum als erwartet. Diese Entwicklung zeige auf, dass die AHV in einer «systematische[n] Angstmacherei zulasten der Bevölkerung» schlechtgeredet werde, liess der SGB verlauten. Die NZZ erachtete diese Zahlen trotz der Korrekturen noch immer als schlecht, «die AHV [werde] so oder so ins Minus» rutschen.

Im Juni 2022 entschied die SGK-SR, dass ihr Entwurf zur Pensionskassenreform BVG21 noch nicht reif für die Behandlung in der Herbstsession 2022 sei. Die Gegnerinnen und Gegner der AHV21-Reform sahen darin einen Versuch, kritische Debatten zur BVG21-Reform vor der Abstimmung über die AHV21 zu verhindern. Doch auch Befürwortende der AHV21-Reform störten sich an diesem Vorgehen der Kommission, zumal man bei einer Behandlung der BVG21-Reform den Frauen hätte zeigen wollen, dass man als Ausgleich zur Rentenaltererhöhung wie mehrfach versprochen ihre Pensionskassenrenten erhöhen werde.

Zu medialen Diskussionen führten in der Folge auch die Vorumfragen. Bereits Anfang Mai berichtete die SonntagsZeitung mit Verweis auf eine Umfrage des Marktforschungsinstituts Demoscope, welche gemäss SonntagsBlick von den Befürwortenden in Auftrag gegeben worden war, dass sich 62 Prozent der SP-Sympathisierenden und 59 Prozent der Sympathisierenden der Grünen für die AHV21 aussprechen wollten. Insgesamt machte die Studie eine Zustimmung zur AHV21 von 55 Prozent aus. Darob publizierte jedoch der SGB die Resultate einer eigenen, zuvor beim Forschungsinstitut Sotomo in Auftrag gegebenen Studie, gemäss welcher die Sympathisierenden der SP die AHV21 zu 63 Prozent ablehnten, während der durchschnittliche Ja-Stimmenanteil über alle Parteien hinweg bei 48 Prozent zu liegen kam. Die Diskussion darüber, wie verlässlich Studien sind, welche von den Befürwortenden respektive der Gegnerschaft einer Vorlage in Auftrag gegeben werden, währte in den Medien jedoch nicht lange. Ab August konzentrierte sich die mediale Debatte auf die Vorumfragen von SRG/gfs.bern und Tamedia/Leewas, welche auf eine mehr oder weniger deutliche Annahme der zwei Vorlagen hindeuteten (Mehrwertsteuererhöhung: zwischen 54 und 65 Prozent, AHVG: zwischen 52 und 64 Prozent). Vor allem zeichnete sich in den Vorumfragen aber bereits ein deutlicher Geschlechtergraben ab, so sprachen sich beispielsweise Anfang August 2022 in der ersten Tamedia-Umfrage 71 Prozent der Männer für die Änderung des AHVG und somit für die Erhöhung des Frauenrentenalters aus, während diese nur 36 Prozent der Frauen befürworteten.

Hatten die Vorumfragen letztlich doch eine relativ deutliche Annahme beider AHV21-Vorlagen in Aussicht gestellt, wurde es am Abstimmungssonntag für die Gesetzesänderung sehr eng: Mit 50.55 Prozent Ja-Stimmen und gut 31'000 Stimmen Unterschied sprach sich die Stimmbürgerschaft für Annahme der Reform aus. Deutlicher fiel das Verdikt für die Zusatzfinanzierung über eine Mehrwertsteuererhöhung aus (55.07%).


Abstimmung vom 25. September 2022

Änderung des Bundesgesetzes über die Alters- und Hinterlassenenversicherung (AHVG; AHV21)
Beteiligung: 52.2%
Ja: 1'442'591 Stimmen (50.5%)
Nein: 1'411'396 Stimmen (49.5%)

Bundesbeschluss über die Zusatzfinanzierung der AHV durch eine Erhöhung der Mehrwertsteuer
Beteiligung: 52.2%
Ja: 1'570'813 Stimmen (55.1%)
Nein: 1'281'447 Stimmen (44.9%)

Parolen:
-Ja: SVP, FDP, Mitte, GLP, EVP, EDU; Economiesuisse, SAV, SBV, SGV
-Nein: SP, GPS, PdA, SD; SGB, Travail.Suisse, VPOD
* in Klammern Anzahl abweichender Kantonalsektionen


«Männer haben Frauen überstimmt», titelte in der Folge der «Blick», von einem «eklatante[n] Geschlechtergraben, wie es ihn noch nie gegeben hat», sprach die WOZ. In der Tat zeigten verschiedene Nachbefragungen einen grossen Zustimmungsunterschied zwischen Frauen und Männern. In der Vox-Analyse lag die Zustimmung zur Gesetzesänderung bei den Frauen im Schnitt bei 38 Prozent, bei den Männern bei 64 Prozent – wobei die direktbetroffenen Frauen unter 65 Jahren der Vorlage nur mit 25 Prozent (18-39 Jährige) respektive mit 29 Prozent (40-64 Jährige) zustimmten, die Frauen im Rentenalter hingegen mit 63 Prozent. In der Folge kam es in Bern und anderen Städten zu Demonstrationen, in denen Teile der Gegnerinnen der Vorlage ihre Wut über das Ergebnis ausdrückten. In einer Rede zeigte sich Tamara Funiciello (sp, BE) gemäss Medien empört darüber, dass «alte, reiche Männer» entschieden hätten, dass «Kita-Mitarbeiterinnen, Nannys, Reinigungskräfte und Pflegefachfrauen» länger arbeiten müssten. Dies führte im Gegenzug zu Unmut bei Vertreterinnen und Vertretern der bürgerlichen Parteien, welche kritisierten, dass «die Linke» den Stimmentscheid nicht akzeptieren wolle. Zudem sprach Regine Sauter (fdp, ZH) Funiciello die Berechtigung ab, im Namen aller Frauen zu sprechen, zumal Frauen keine homogene Masse bildeten. Funiciello hingegen betonte gemäss Tages-Anzeiger, dass es «für Verbesserungen [...] den Druck von der Strasse und den Dialog im Bundeshaus» brauche.

Doch nicht nur zwischen den Geschlechtern, auch zwischen den Sprachregionen zeigten sich bereits am Abstimmungssonntag grosse Unterschiede. Sämtliche mehrheitlich romanischsprachigen Kantone lehnten die Reform ab, allen voran die Kantone Jura (29% Ja-Stimmen), Neuenburg (35%) und Genf (37%), während sich nur drei deutschsprachige Kantone mehrheitlich gegen die Reform des AHV-Gesetzes aussprachen (Basel-Stadt: 47% Zustimmung; Solothurn: 49.8%, Schaffhausen: 50.0%). Die höchste Zustimmung fand sich in den Kantonen Zug (65%), Nidwalden (65%) und Appenzell-Innerrhoden (64%). «Die Deutschschweiz sichert die AHV», bilanzierte folglich etwa die NZZ, während SGB-Präsident und Nationalrat Maillard (sp, VD) die Unterschiede zwischen den Sprachregionen kritisierte, neben dem Geschlechtergraben und dem Sprachgraben aber auch einen Einkommensgraben ausmachte. Diese Ergebnisse bestätigte später auch die Vox-Analyse, welche für Personen mit Haushaltseinkommen unter monatlich CHF 3'000 eine deutlich tiefere Zustimmung zur Gesetzesänderung ermittelte als für Personen mit höheren Haushaltseinkommen (unter CHF 3'000: 32%; CHF 3'000-5'000: 49%, CHF 5'000-9'000: 52%, CHF 9'000-11'000: 59%, CHF über 11'000: 60%). Dieselben Unterschiede waren jeweils auch bei der Mehrwertsteuererhöhung erkennbar, wenn auch in geringerem Ausmass.

Als Motive für ihren Stimmentscheid machte die Vox-Analyse bei den Befürwortenden die Notwendigkeit zur Stabilisierung der AHV aus – sowohl bei der Gesetzesänderung (41%) als auch bei der Mehrwertsteuererhöhung (64%) wurde dieser Punkt häufig genannt. Zusätzlich erachteten aber die Befürwortenden die Gesetzesänderung – also wohl vor allem die Rentenaltererhöhung – auch als Schritt hin zur Gleichberechtigung (45%). Die Gegnerinnen und Gegner erachteten sowohl die Gesetzesänderung als ungerecht (84%), insbesondere im Hinblick auf die Lohnungleichheit zwischen Frauen und Männern, als auch auf die Mehrwertsteuererhöhung (46%), die vor allem einkommensschwache Personen treffe und allgemein ein «schlechtes Finanzierungsmittel» (Vox-Analyse) darstelle.

Bereits am Tag nach der Volksabstimmung zur AHV21 schwenkte das mediale Interesse weg von der Reform der AHV hin zur BVG21-Reform. Denn nicht nur die Gegnerinnen und Gegner der AHV21-Reform, sondern auch weite Teile der Befürwortenden wiesen auf die Verpflichtung oder gar das «Versprechen» (AZ) hin, die mit dieser Annahme der Reform einhergingen: Im Gegenzug müsse das Bundesparlament die Benachteiligung der Frauen bei der Altersvorsorge im Rahmen der anstehenden BVG21-Reform korrigieren.

Reform «Stabilisierung der AHV (AHV 21)» (BRG 19.050)
Dossier: Debatten um das Frauenrentenalter
Dossier: Erhöhung des Rentenalters

Im Februar 2021 lancierte die WBK-NR mit 15 zu 9 Stimmen eine parlamentarische Initiative mit dem Ziel, das bereits mehrfach verlängerte Impulsprogramm für die Schaffung von Betreuungsplätzen in familienergänzenden Strukturen von einer zeitlich befristeten in eine stetige Lösung zu überführen. Die Kommission tat dies in Kenntnis eines jüngst erschienenen bundesrätlichen Berichts «Politik der frühen Kindheit» und unter anderem nach Konsultation der Konferenz der kantonalen Sozialdirektorinnen und Sozialdirektoren (SODK), des Gewerkschaftsbundes und des Schweizerischen Arbeitgeberverbandes.
Gleichzeitig beantragte die Kommissionmehrheit, einer parlamentarischen Initiative Prelicz-Huber (gp, ZH; Pa.Iv. 20.413) mit der Forderung nach Schaffung einer Verfassungsgrundlage für familien- und schulergänzende Betreuung keine Folge zu geben. Weiter wollte die Kommission die parlamentarische Initiative Aebischer (sp, BE) zur Förderung der Chancengleichheit vor dem Kindergarteneintritt aufgrund der in Angriff genommenen Arbeiten bis Ende Jahr sistieren.

Überführung der Anstossfinanzierung in eine zeitgemässe Lösung (Pa.Iv. 21.403)
Dossier: Finanzhilfen zur Förderung familienergänzender Kinderbetreuung

Au lendemain du 14 juin, les syndicats se sont annoncés bien décidés à ce que les suites de la grève féministe et des femmes donnent lieu à un puissant mouvement social et militant. L'Union syndicale suisse (USS) a présenté lors d'une conférence de presse, à Berne, les revendications qui seront poursuivies à la suite du 14 juin. L'égalité salariale reste l'objectif phare, ainsi que la garantie de retrouver son travail après un congé maternité. Le congé paternité est présenté comme une première étape, qui devra être suivie par un congé parental. De même, des mesures contre le harcèlement et les comportements sexistes sur le lieu de travail devront être prises. Les femmes issues de l'immigration sont des actrices nécessaires au marché du travail, même lorsqu'elles ne bénéficient pas de statut de séjour légal. Michaela Bovolenta de l'USS a annoncé vouloir défendre leur droit de rester et d'être régularisées.
En septembre, lors de la traditionnelle demande de hausse généralisée des salaires, les syndicats ont émis une revendication supplémentaire: ils réclament un rattrapage de salaire de 50 francs par mois pour chaque femme active. De plus, les femmes travaillant dans l'industrie agro-alimentaire et touchant moins de 4000 francs par mois devraient être augmentées de 200 francs mensuels.

Les suites de la grève féministe et des femmes

L'USS a présenté ses revendications, en rapport avec la grève des femmes. Les syndicats réclament un salaire minimum de 4'000 CHF et des conventions collectives de travail (CCT) couvrant les branches à forte proportion féminine; un congé paternité de 24 semaines pour les parents, financé par les allocations pour perte de gains (APG); davantage de protection contre les licenciements en cas de maternité; une meilleure prévention en matière de lutte contre le harcèlement sexuel et psychologique; la semaine de travail à 35 heures.
Sans surprise, l'Union patronale Suisse (UPS) s'oppose à la plupart des demandes. Pour une meilleure intégration et rémunération des femmes sur le marché du travail, elle est en faveur des horaires flexibles et incite les programmes pour améliorer la conciliation entre vie professionnelle et familiale. Quant à la semaine de 35 heures, la mesure malmènerait la compétitivité des entreprises. Il ne faudrait pas uniformiser les horaires, mais régler la question à l'intérieur de chaque branche.

Revendications syndicales pour la grève des femmes
Dossier: Feministisches Jahr 2019?

Un des premiers pas vers la grève féministe et des femmes* du 14 juin 2019 a été franchi lors des assises féministes romandes en juin 2018. Un groupe d'environ 120 femmes, issues des milieux syndical, politique, culturel ou simplement de la société civile ont réagi aux mobilisations internationales (manifestations contre l'interdiction de l'avortement en Pologne, contre les violences sexistes en Argentine, Women's march contre le président Trump aux USA, grèves féministes en Espagne et mouvement #metoo) et ont voulu apporter leur pierre à l'édifice. Le renvoi en commission de l'article sur l'égalité par le Conseil des Etats a également joué le rôle de déclencheur.

Le choix de la date du 14 juin se situe dans la lignée historique des mobilisations féministes en Suisse. Le 14 juin 1981, dix ans après l'obtention du droit de vote pour les femmes, le principe d'égalité était entériné dans la Constitution. Or, comme trop peu de progrès ont été constatés, une grève des femmes nationale a été lancée par l'Union syndicale suisse, exactement dix ans plus tard. En ce 14 juin 1991, plus de 500'000 femmes ont manifesté, faisant grève, pour celles qui le pouvaient, du travail, qu'il soit domestique ou salarié. Des balais et serpillières étaient suspendus aux fenêtres, les maîtresses d'écoles et travailleuses de crèche sont descendues dans la rue avec les enfants, une grève de la consommation a été revendiquée. La revendication principale de 1991 était l'ancrage dans la loi de l'article constitutionnel sur l'égalité. S'ensuivait une série de revendications tournant principalement autour du travail (égalité salariale, places de crèches à prix accessible, interdiction du travail de nuit pour tou-te-s, formation continue, etc.) et des violences (protection contre le harcèlement et les abus sexuels au travail et dans la vie privée). La loi demandée a été votée en 1995, et depuis, quelques victoires pour la cause des femmes ont été obtenues: légalisation de l'avortement en 2002 et congé maternité en 2005.

Pour les organisatrices de la grève de 2019, ce n'est de loin pas suffisant. Un nouveau manifeste a été rédigé, comprenant une vingtaine de revendications. Le thème du travail y est encore présent, avec des revendications comme celles de l'arrêt de la discrimination, de la valorisation du travail domestique et de care, ainsi que des rentes qui permettent de vivre dignement. La question des violences fait également écho aux demandes de 1991, avec des revendications pour une prise au sérieux plus importante des victimes de viol ou d'abus. Le manifeste de 2019 se distingue de son prédécesseur par une prise en compte plus importante de l'intersectionnalité, comme en témoigne l'astérisque accolé au mot «femme*» dans les communications relatives à la grève. Cet astérisque signifie que le terme «femme*» s'applique ici à tou-te-s, à l'exception des hommes cisgenre. Ainsi, les personnes trans, queer ou intersexe sont représentées par le mouvement. Ce souci des personnes qui sont traditionnellement peu représentées dans le débat public s'illustre par un nombre important de revendications. Le manifeste exige la fin des discriminations pour les personnes LGBTQIA+ et une éducation plus importante aux choix en termes de genre et de sexualité. Les femmes* non suisses ou sans titre de séjour légal sont également représentées dans le manifeste, puisque ce dernier réclame la fin des discriminations racistes, la prise en compte du travail fourni par les femmes* sans papiers et la reconnaissance des violences sexistes et de genre comme motif d'asile. Un nombre important de revendications s'attaque aux stéréotypes de genre, demandant une formation des personnes travaillant dans les écoles sur ces questions. De même, une éducation sexuelle qui aborde également la vie affective et sexuelle, le plaisir, et spécialement le plaisir féminin ainsi que les variétés d'orientation sexuelles et de genre doit, selon le manifeste être dispensée dans les écoles par des spécialistes de la santé sexuelle. Un appel à une société moins autoritaire, plus ouverte, plus horizontale, en définitive, moins patriarcale, clôt le manifeste.

Le mouvement pour la grève féministe et des femmes* 2019 se compose de plus d'une vingtaine de collectifs locaux et de nombreux groupes informels qui ont pour but d'animer la journée du 14 juin. Les séances d'organisation et de coordination de la grève étaient non mixtes, pour permettre aux femmes* de mener elles-mêmes leur lutte. Les hommes sont les bienvenus pour apporter leur aide, en soutien. Cette décision a été à la source de nombreuses critiques, mais a été maintenue, car il est selon les organisatrices crucial pour les femmes* de s'emparer de la parole à cette occasion, leurs voix n'étant que trop peu entendues le reste du temps. Plusieurs collectifs d'hommes solidaires ont d'ailleurs vu le jour, ces messieurs se proposant de remplacer au travail les femmes* qui ne pourraient sinon pas participer ou alors de s'occuper des garderies prévues sur les sites des différentes manifestations le jour J.

L'appel à la grève a été formellement lancé le 10 mars, lors des assises féministes qui ont suivi la journée internationale de lutte pour les droits des femmes, le 8 mars 2019.

Grève féministe et des femmes* du 14 juin 2019
Dossier: Feministisches Jahr 2019?
Dossier: Gewalt gegen Frauen* / häusliche Gewalt (ab Ratifikation Istanbul-Konvention)

Suite au congrès des femmes de l’USS, la section femmes du SSP, quelques militantes et le parti solidaritéS ont décrété des assises féministes. Durant cette rencontre nationale, qui a eu lieu à Bienne le 10 mars 2019, le projet de grève féministe et des femmes* a été voté. Celle-ci a été fixée au 14 juin 2019, à savoir la même date, 28 ans après, que la grève du 14 juin 1991.

Assises féministes
Dossier: Feministisches Jahr 2019?

Am 1. Dezember 2018 wurde Pierre-Yves Maillard zum neuen Präsidenten des Schweizerischen Gewerkschaftsbundes gewählt. Maillard setzte sich mit 115 Stimmen gegen Nationalrätin Barbara Gysi (sp, SG) durch, die 82 Stimmen erhielt. Bereits im September hatten sowohl Marina Carobbio (sp, TI) als auch Mathias Reynard (sp, VS) ihre Kandidaturen zurückgezogen.
Mit dem Entscheid der Delegierten ging auch eine Debatte zu Ende, die seit der Rücktrittsverkündigung Rechsteiners im März angedauert hatte. Viele Delegierte wünschten sich nun, nachdem Rechsteiner das Amt zwanzig Jahre ausgeübt hatte, eine Frau an der Spitze des SGB. Der Wahlkampf zwischen Gysi und Maillard, insbesondere die Diskussion um die Gleichstellungsfrage, wurde landesweit in der Tagespresse aufgegriffen – ganz im Zeichen des diesjährig abgehaltenen Frauenstreiks. Zwar unterschieden sich die politischen Profile Gysis und Maillards kaum, wie die WOZ festhielt, doch verkörpere Maillard eine «vergangene Epoche, in der in den gewerkschaftlich organisierten Branchen fast ausschliesslich Männer arbeiteten», während die Zukunft aber weiblicher sein müsse. Gysi verfolgte mit der Wahl denn auch das Ziel, sich vermehrt gegen arbeitnehmerische Missstände wie eine schlechte Vereinbarkeit von Beruf und Familie oder tiefe Frauenlöhne einzusetzen, wie sie gegenüber dem St. Galler Tagblatt im September bekannt gab. Zudem sei die knapp eingehaltene Mindestquote von einem Drittel Frauen in den Leitungsgremien des SGB zu tief angesetzt und es gelte, vermehrt Frauen für eine Mitgliedschaft in einer Gewerkschaft anzuwerben – besonders im Hinblick auf den Mitgliederschwund, mit welchem die Gewerkschaften zu kämpfen hätten. Für ihre Anliegen, so das Tagblatt weiter, spüre die St. Gallerin aus allen Landesteilen Rückhalt, doch erhalte sie diesen nicht nur aufgrund der Gleichstellungsanliegen: Sie könne auf eine jahrelange Tätigkeit im Nationalrat zurückblicken und sei seit 1989 gewerkschaftlich aktiv.
Ihre Niederlage im Dezember begründete die Presse jedoch weder mit ihrem Geschlecht noch mit ihrer Herkunft – auch Rechsteiner ist St. Galler –, sondern mit dem Umstand, dass Maillard als Macher bekannt sei. Mit der Einführung eines dreizehnten Monatslohns sowie fünf Wochen Ferien für alle Arbeitnehmenden wolle Maillard realisierbare Projekte anpacken. Gysi habe indes auch die Einführung einer Viertagewoche in Erwägung gezogen, die, wäre es in der Folge zu einer Abstimmung kommen, an der Urne wohl gescheitert wäre, wie die Presse prognostizierte. Auch die NZZ porträtierte Maillard als Macher, indem sie den Wahlerfolg damit begründete, dass es ihm als Regierungsrat der Waadt gelungen sei, aus einem «rechten Kanton» einen Kanton mit einer «linksdominierten Regierung» zu machen. Höhere Kinderzulagen, Prämienverbilligungen und Ergänzungsleistungen für Alleinerziehende seien in der Folge im Kanton auf Akzeptanz gestossen. Ausschlaggebend sei ferner gewesen, dass Maillard als Streikführer und Funktionär des SMUV mehr «gewerkschaftlicher Stallgeruch» angehaftet habe als Gysi.
Die grösste Herausforderung für den neuen SGB-Präsidenten, da war sich die Tagespresse einig, werde indes sein, den Lohnschutz der Bilateralen erfolgreich im Rahmenvertrag mit der EU unterzubringen.

Rechsteiner tritt als Präsident des SGB zurück

Auch wenn die Schlussabstimmung betreffend die Parole des Schweizerischen Gewerkschaftsbunds (SGB) zur Reform der Altersvorsorge 2020 letztendlich mit 98 zu 21 Stimmen deutlich zugunsten der AHV-Reform ausfiel, zeigte die Delegiertenversammlung am 24. März 2017 eine Spaltung zwischen Deutschschweizer und Westschweizer Gewerkschafterinnen und Gewerkschaftern. Über 30 SGB-Delegierte äusserten sich vor der Parolenfassung; Hauptstreitpunkt war, ob die Erhöhung der AHV um monatlich CHF 70 eine Erhöhung des Frauenrentenalters rechtfertige. Solange die Frauen bei den Löhnen diskriminiert würden, dürfe das Rentenalter nicht erhöht werden, lautete der Tenor bei vielen Delegierten aus der Westschweiz. Ein Waadtländer Delegierter etwa warf SGB-Präsident Paul Rechsteiner Verrat vor, weil sich der Gewerkschaftskongress 2014 in einer Resolution klar gegen eine Erhöhung des Frauenrentenalters ausgesprochen habe. Unia-Präsidentin Vania Alleva entgegnete, dass in der gleichen Resolution die Erhöhung der AHV-Renten gefordert werde. Paul Rechsteiner strich die historische Dimension der Vorlage hervor: «Zum ersten Mal seit 42 Jahren könnte eine Erhöhung der AHV-Rente Realität werden», zitierte ihn die Luzerner Zeitung. Die grosse Mehrheit der Delegierten war sich einig: Würde die Vorlage abgelehnt, würde dies dem Arbeitgeberverband und den rechts-bürgerlichen Parteien nützen, womit deren Forderungen wie Rentenalter 67 und Rentenkürzungen Auftrieb erhielten, schrieb der SGB in einer Medienmitteilung. Dies gelte es zu verhindern, weshalb diese «Kröte», wie der SGB die Erhöhung des Frauenrentenalters bezeichnete, geschluckt werden müsse. Zusätzlich einigten sich die Delegierten darauf, dass die Lohnungleichheit zwischen Mann und Frau «endlich stärker bekämpft werden muss». Sie beauftragten den SGB, die Lancierung einer Volksinitiative mit dem Namen «Schluss mit dem Lohnklau – Lohngleichheit durchsetzen, aber subito!» zu prüfen.

SGB für höheres Frauenrentenalter

Der Gewerkschaften zeigten sich alarmiert ob der harzigen Umsetzung der Forderung nach Lohngleichstellung von Frau und Mann. Nach positiven Anzeichen zu Beginn der neunziger Jahre herrsche in der Frage der Frauenlöhne heute wieder „tiefste Eiszeit“. Die Lohndifferenz für gleichwertige Arbeit betrage im öffentlichen Sektor noch immer 11%, im privaten Sektor sogar 23%. Zudem drohten die diversen Verwaltungsreformen und Personalgesetzänderungen bisher Erreichtes zunichte zu machen. In der Kritik der Gewerkschaften stehen auch die Schweizer Gerichte. Bei der Behandlung von Lohngleichheitsklagen würden zentrale Errungenschaften der Gleichstellung wieder ausgehöhlt. So seien in jüngster Zeit diverse Klagen mit dem Argument abgeschmettert worden, das Gesetz des Marktes rechtfertige eine ungleiche Entlöhnung.

Lohngleichstellung Gerichte

Wegen der progressiven Anhebung des Rentenalters der Frauen ergriffen der Christlich-nationale Gewerkschaftsbund (CNG) und der Schweizerische Gewerkschaftsbund (SGB) gegen die 10. AHV-Revision das Referendum, wobei Ende Jahr bereits feststand, dass dieses mit weit über 100'000 Unterschriften zustande kommen wird. Die mit dem SGB eng verbundene SP zeigte sich in dieser Angelegenheit gespalten. Die Geschäftsleitung unter Präsident Bodenmann stellte sich hinter das Referendum, der Parteivorstand hingegen wollte die positiven Aspekte der Revision - Rentensplitting, Erziehungs- und Betreuungsgutschriften - nicht gefährden und sprach sich dagegen aus. Die Partei beschloss schliesslich, der SP-Basis diesen schwierigen Entscheid anfangs 1995 in einer Urabstimmung zu unterbreiten, der ersten seit 1921, als sich die Genossinnen und Genossen für oder gegen einen Beitritt zur 3. Internationalen zu entscheiden hatten.

10. AHV-Revision (BRG 90.021)
Dossier: 10. Revision der Alters- und Hinterlassenenversicherung (AHV; 1980-1998)
Dossier: Debatten um das Frauenrentenalter

Der SGB gab sich an seinem ausserordentlichen Kongress vom 9. und 10. Juni in Bern ein neues Arbeitsprogramm. Dieses zeichnet sich im wesentlichen durch Kontinuität aus, postuliert aber auch eine grössere Bedeutung des Engagements für die Gleichstellung der Geschlechter in Beruf, Gesellschaft und Familie.

Neues Arbeitsprogramm des SGB 1992

Der Schweizerische Gewerkschaftsbund (SGB) und die SP reichten mit 118'264 gültigen Unterschriften ihre Volksinitiative «zum Ausbau von AHV und IV» ein, die zum Ziel hat, AHV und IV weitgehend existenzsichernd zu gestalten. Die Pensionskassen sollten dagegen abgebaut werden und deutlicher als heute die Funktion einer Zusatzversicherung erhalten. Gleichzeitig wollen die Initianten die Gleichstellung von Mann und Frau erreichen und die heutige Ehepaarrente durch eine Einzelrente (Splitting) ersetzen.

Volksinitiative «zum Ausbau von AHV und IV»
Dossier: Volksinitiativen zur Altersvorsorge (seit 2015)

Die Klage von 22 Gewerkschafterinnen gegen ihre eigene Gewerkschaft Druck und Papier wegen des Abschlusses eines Gesamtarbeitsvertrags, welcher für ungelernte Frauen tiefere Löhne als für Männer vorsah, war erfolgreich. Der Appellationshof des bernischen Obergerichtes erklärte die gewerkschaftliche Urabstimmung über den Gesamtarbeitsvertrag für ungültig, weil dieser gegen das in Artikel 4 BV festgelegte Lohngleichheitsprinzip verstösst.

Unterschiedliche Mindestlöhne für Frauen und Männer im Buchbindergewerbe stösst auf Widerstand

Die von Ständerat Otto Schoch (fdp, AR) geleitete Kommission präsentierte ihren Gesetzesentwurf Mitte Dezember der Öffentlichkeit. Sie befürwortete eine obligatorische Krankenpflegeversicherung für die gesamte Bevölkerung, gleiche Prämien für Mann und Frau, für Junge und Alte, völlige Freizügigkeit für alle Versicherten und einen Lastenausgleich zwischen den einzelnen Kassen.

Im Bereich der Leistungen schlug die Kommission Verbesserungen für die Versicherten vor: Die Beschränkung der Leistungsdauer für Spitalpflegeaufenthalte — heute 720 Tage — sollte entfallen, Hauskrankenpflege, Prävention und Zahnbehandlungen im Zusammenhang mit schweren Erkrankungen neu von den Kassen vergütet werden. Trotz Ausbau der Leistungen erachtete die Kommission ihren Gesetzesentwurf als Beitrag zur Kostendämpfung, da die Versicherten durch grössere Transparenz bei den Abrechnungen, einen auf 15% angehobenen Selbstbehalt und das Angebot alternativer Versicherungsformen (HMO) verantwortungsbewusster werden sollten. Im Gegenzug müssten sich die Anbieter — in erster Linie Ärzte und Spitäler — einer Kontrolle der Wirtschaftlichkeit ihrer Leistungen unterziehen.

Nach den Vorstellungen der Kommission soll die Krankenversicherung weiterhin durch Kopfprämien und Beiträge der öffentlichen Hand finanziert werden. Die Bundessubventionen sollen neu zu einem Drittel für Mutterschaftsleistungen und den Ausgleich der höheren Betagten-Kosten eingesetzt werden und zu zwei Dritteln für individuelle Prämienverbilligungen für Personen, deren Familienprämie einen bestimmten prozentualen Anteil ihres Einkommens und Vermögens übersteigt. Im Vordergrund der Diskussionen stand hier ein Prozentsatz von 7%, was heissen würde, dass über die Hälfte der Bevölkerung in den Genuss dieser Subventionen käme. Damit könnten auch sozial Schwächere die durch den Leistungsausbau notwendig werdende Erhöhung der Prämien um durchschnittlich 24% für Männer und 12% für Frauen verkraften.

Die Vorschläge der Kommission Schoch wurden von den Parteien recht freundlich aufgenommen. Für die FDP gingen die angestrebten Reformen in die richtige Richtung, auch wenn die relativ beschränkte Kostenkontrolle zu einem weiteren Anstieg der Gesundheitskosten führen werde. Die CVP begrüsste mit Blick auf den Solidaritätsgedanken das Obligatorium sowie die gezielte Prämienverbilligung durch den Bund. Dem Obligatorium skeptisch gegenüber stand hingegen die SVP, welche zudem bemängelte, kostendämpfende Elemente seien zu wenig berücksichtigt worden. Mit ihrer Kritik befand sie sich auf derselben Linie wie der Gewerbe- und der Arbeitgeber-Verband.

SP und Gewerkschaftsbund zeigten sich erfreut über die Einführung des Obligatoriums und die angestrebten Prämienentlastungen für einkommensschwache Personen. Sie bedauerten aber, dass mit der vorgeschlagenen Erhöhung des Selbstbehalts die Kostenfolgen erneut auf die Versicherten überwälzt würden und verlangten weitergehende gezielte Prämienverbilligungen. Zudem erinnerten sie daran, dass eine von ihnen 1986 eingereichte Volksinitiative "für eine gesunde Krankenversicherung", welche unter anderem die Kopfprämien durch Lohnprozente ersetzen will, nach wie vor hängig ist.

Bundesrat Cotti zeigte sich ebenfalls zufrieden mit der Arbeit der Kommission Schoch. Er kündigte an, dass ein Revisionsentwurf im Februar 1991 in die Vernehmlassung gehen soll. Die definitive Vorlage will der Bundesrat spätestens im Herbst 1991 präsentieren, also noch vor der Abstimmung über die beiden hängigen Krankenkassen-Initiativen (siehe hier und hier).

Revision der Krankenversicherung – Schaffung des KVG (BRG 91.071)
Dossier: Schaffung des Bundesgesetzes über die Krankenversicherung (KVG; 1988-1994)
Dossier: Prämienverbilligung

An seinem Kongress in Interlaken beschloss der SGB auf Antrag des SMUV einstimmig, am 14. Juni 1991 einen landesweiten Frauenstreik zu organisieren. Damit soll darauf aufmerksam gemacht werden, dass auch zehn Jahre nach der Annahme des Gleichheitsartikels in der Bundesverfassung die Gleichstellung der Geschlechter, namentlich im Lohnbereich, noch nicht verwirklicht ist.

Organisation des SGB für ein nationaler Frauenstreik

Die Auseinandersetzungen über einen neuen Gesamtarbeitsvertrag für das Buchbindergewerbe zeigte, dass sich selbst die Gewerkschaften mit der lohnmässigen Gleichstellung der Geschlechter zum Teil noch schwer tun. Auf Empfehlung der leitenden Gremien der Gewerkschaft Druck und Papier (GDP) hätten die Gewerkschaftsmitglieder einem Vertrag zustimmen sollen, der bei den Ungelernten unterschiedliche Mindestlöhne für Frauen und Männer vorsah. Die – vom SGB-Kongress mit einer Resolution unterstützte – Frauenkommission der GDP reichte rechtliche Klage ein und erwirkte damit einen Aufschub der Vertragsunterzeichnung.

Unterschiedliche Mindestlöhne für Frauen und Männer im Buchbindergewerbe stösst auf Widerstand

Suivant les recommandations du Conseil fédéral et des Chambres, le peuple a rejeté l'initiative lancée par les Organisations progressistes (POCH) demandant qu'en l'espace de trois ans l'âge ouvrant le droit à la rente AVS soit abaissé à 62 ans pour les hommes et à 60 ans pour les femmes. Soutenue par le Parti du travail et le Parti socialiste ouvrier, l'initiative précisait en outre que cet âge pouvait être ultérieurement abaissé par voie législative, mais qu'il ne pouvait être relevé. En effet, les initiants proposaient que l'âge donnant droit aux rentes soit atteint en deux étapes. La première fixant la limite à 62 ans pour les hommes et 60 pour les femmes, la seconde devant établir l'égalité entre homme et femme. Au cours du débat qui a précédé le scrutin populaire, partisans et adversaires de l'abaissement de l'âge de la retraite ont tour à tour invoqué des motifs d'ordre démographique, financier, économique et social pour étayer leur argumentation.

Les opposants ont estimé que les conséquences financières de cette requête populaire n'étaient supportables ni pour les salariés ni pour l'économie et pas davantage pour les pouvoirs publics. L'acceptation de cette initiative aurait entraîné, selon le Conseil fédéral, des dépenses supplémentaires de l'ordre de 2,1 milliards de francs par an. Comme les initiants excluaient toute possibilité d'abaisser le montant des rentes, il en aurait résulté, toujours selon les estimations du gouvernement, une augmentation des prélèvements sur les salaires de 1,55% ainsi qu'un accroissement de la charge de la Confédération et des cantons de 295 millions de francs. L'initiative aurait également eu des répercussions d'ordre financier sur d'autres branches de la sécurité sociale, notamment sur le régime des prestations complémentaires à l'AVS et sur la prévoyance professionnelle. A propos du financement, les initiants ont tenu à rappeler que les contributions de la Confédération avaient été réduites de 25 à 20% lors de la 9e révision de l'AVS et ont suggéré que l'accroissement de la charge des pouvoirs publics soit compensé par une diminution des dépenses militaires afin de n'entraîner aucune augmentation des cotisations salariales.
L'inexorable vieillissement de la population, conjugué à une espérance de vie en constante augmentation, a permis aux opposants de présenter l'initiative comme dangereuse pour le financement futur de l'AVS. En effet, l'évolution démographique de la Suisse entraîne une détérioration du rapport entre cotisants et rentiers. Une baisse de l'âge donnant droit à la rente constituerait à leurs yeux une mise en danger de la sécurité sociale. Autre argument brandi par les opposants, la menace que fait peser l'initiative sur la 10e révision de l'AVS.

L'aspect social et humain de l'âge de la retraite a également servi d'argument pour les partisans comme pour les adversaires de l'initiative. Pour les premiers cités, un abaissement de l'âge de la retraite permet une réelle amélioration de la qualité de la vie, répond à une nécessité sociale et s'appuie sur un réel désir de nombreux salariés. Quant aux seconds, ils ont souligné que, face à une espérance de vie toujours plus longue, de nombreux travailleurs redoutent un retrait prématuré de la vie professionnelle, signe pour eux d'une mise au ban de la société.


Initiative visant à abaisser l'âge donnant droit à la rente AVS. Votation du 12 juin 1988
Participation: 42,0%
Non: 1 153 540 (64,9%) / 21 cantons
Oui: 624 390 (35,1%) / 2 cantons (TI, JU)

Mots d'ordre:
Non: PRD, PDC, UDC, PLS, AdI, PEP, PES, AN, PA; Vorort, UCAP, USAM, USP, Assoc. suisse des employés.
Oui: PSS, POCH, PST, Alliance verte; USS, CSCS, Confédération romande du travail.


L'analyse Vox réalisée à l'issue du scrutin a démontré que le souverain avait rejeté l'initiative en raison des risques financiers qu'elle aurait pu entraîner. Pour les opposants, la Suisse n'est pas assez riche pour supporter un accroissement du nombre des personnes jouissant des rentes AVS. Toujours selon cette analyse, le déséquilibre croissant entre le nombre de cotisants et celui des bénéficiaires des rentes a également constitué un motif de rejet. La minorité qui s'est dégagée des urnes et les motifs qui ont incité les votants à rejeter l'initiative, permettent cependant d'avancer l'hypothèse suivant laquelle un relèvement de l'âge de la retraite serait mal perçue par une large part de la population. Ce résultat peut conforter la position du Conseil fédéral qui, malgré les pressions des milieux économiques, a refusé de procéder à un relèvement de l'âge de la retraite pour les femmes dans son programme pour la 10' révision de l'AVS.

Initiative populaire visant à abaisser l'âge de la retraite des hommes (à 62 ans) et pour les femmes (à 60 ans; BRG 85.045)
Dossier: Debatten um das Frauenrentenalter

Dans son message relatif à l'initiative populaire des POCH, laquelle vise à abaisser à 62 ans pour les hommes et à 60 ans pour les femmes l'âge donnant droit à la retraite, l'exécutif invoque avant tout des motivations de nature financière pour recommander le rejet de celle-ci sans lui opposer de contre-projet. En effet, la concrétisation de cette proposition entraînerait des charges supplémentaires, jugées inacceptables, pour les pouvoirs publics, les salariés et l'économie nationale, ainsi que des modifications dans d'autres branches de notre sécurité sociale, à la défaveur de certaines catégories d'assurés. De même, la prétendue rigidité de la formule des initiants accentuerait les effets négatifs de la structure des âges sur les comptes de l'AVS et les difficultés sur le front de l'emploi, principalement pour les jeunes. Quant à ses aspects humains, un système de retraite anticipée schématique et unilatéral ne correspondrait pas à un besoin général. Les associations patronales se sont estimées satisfaites de cet argumentaire. Elles ont toutefois regretté que le Conseil fédéral ait manqué l'occasion de tirer la 10e révision de son néant, en se soustrayant à la formulation d'une alternative. De leur côté, les syndicats ont condamné le caractère par trop partisan de ce message et le refus catégorique du gouvernement d'entrer en matière sur le terrain des auteurs de l'initiative. L'USS a notamment relevé que la position gouvernementale signifiait le rejet de toute forme d'abaissement de l'âge de la retraite et même de la retraite à la carte, si celles-ci entraînaient de nouvelles dépenses pour l'assurance.

Initiative populaire visant à abaisser l'âge de la retraite des hommes (à 62 ans) et pour les femmes (à 60 ans; BRG 85.045)
Dossier: Debatten um das Frauenrentenalter

Parallèlement à ces travaux, les Organisations progressistes (POCH) ont fait campagne pour leur initiative en vue de l'abaissement, cette fois «à 62 ans pour les hommes et à 60 ans pour les femmes», de l'âge donnant droit à la rente AVS. Après que les Parti du Travail (PdT), Parti socialiste autonome (PSA) et Parti socialiste ouvrier (PSO) eurent apporté leur soutien, le succès de la récolte de signatures semblait acquis en fin d'année. Par ailleurs, une étude prospective a avancé l'hypothèse que si les conditions de croissance actuelles se maintenaient, une augmentation du taux de cotisation de l'AVS ne serait pas nécessaire pendant les soixante prochaines années. Tandis que le PdT se félicitait à ce propos de l'«extrême solidité du premier pilier», l'USS faisait observer que le chiffre de 2% de croissance annuelle des salaires réels lui semblait trop optimiste.

Initiative populaire visant à abaisser l'âge de la retraite des hommes (à 62 ans) et pour les femmes (à 60 ans; BRG 85.045)
Dossier: Debatten um das Frauenrentenalter

Als führende Organisation der Arbeitnehmer feierte der Schweizerische Gewerkschaftsbund (SGB) 1980 sein 100jähriges Bestehen. Dies bot in einer breiteren Öffentlichkeit Anlass, Entwicklung und Bedeutung des Gewerkschaftswesens zu würdigen. Der SGB begnügte sich freilich nicht mit einer Rückschau, sondern gab sich nach zwanzig Jahren erstmals wieder ein neues Arbeitsprogramm. Im Unterschied zu 1960/61, als Wachstum, Marktwirtschaft und Sozialpartnerschaft im Vordergrund standen, betonte man nunmehr Qualität vor Quantität, Humanisierung vor Technik, demokratische Kontrolle und Planung neben Wettbewerb sowie Mitbestimmung, ja Selbstverwaltung. Besondere Akzente des Programms bilden Vorbehalte gegenüber der Atomenergie, Forderungen nach völliger Gleichstellung der Frau und nach Befreiung der Medien von Wirtschaftsinteressen und gar Bereitschaft zu Wohlstandseinbussen zugunsten der Dritten Welt. Ein doppeltes Vernehmlassungsverfahren trug zur Profilierung des Dokuments bei, das von den einen als Bestätigung des marktwirtschaftlich-kapitalistischen Systems, von andern als Zuwendung zu Planwirtschaft und Kollektivismus interpretiert wurde.

Schweizerischer Gewerkschaftsbund

La votation fédérale du 7 février sur l'introduction du suffrage féminin fut précédée d'une campagne animée. La Suisse officielle se prononça presque unanimement en faveur de l'acceptation du projet. En 1970, ce dernier avait déjà été admis sans opposition par les deux Chambres. Tous les partis politiques nationaux et certaines associations professionnelles donnèrent la même consigne positive (Partis: PRDS; PSS; PDC; PAB; Indépendants; PdT; Evangéliques; Libéraux. — Associations: USS; FSE; Union des paysannes suisses). Les partis cantonaux suivirent (PAB de Schaffhouse; PRD d'Appenzell Rhodes-Extérieures), à l'exception de quelques rares formations favorables à la liberté de vote. Les opposants se regroupèrent en une Action fédérale contre le droit de vote féminin, sous la présidence de l'avocat argovien Markus Herzig (Plusieurs comités cantonaux se sont constitués pour combattre le projet). Dans la presse, la majorité des voix qui s'élevèrent furent favorables au projet; en Suisse romande, ce fut presque l'unanimité. La radio et la télévision retransmirent des débats contradictoires. Des magistrats fédéraux et cantonaux s'engagèrent par écrit et verbalement en faveur des droits politiques de la femme (Le Conseil fédéral a répondu affirmativement à une petite question du CN Cevey (fdp/prd VD) qui lui demandait de participer activement à la campagne électorale). L'écrasante majorité des prises de position favorables au projet fut telle que les adversaires se plaignirent de ce qu'on étouffait leur voix. Alors que ces derniers fondaient principalement leur argumentation sur les différences de fonction sociale et de mode de vie de la femme, les premiers invoquèrent soit une égalité naturelle de droit, soit l'aptitude de la femme à l'action politique, aptitude confirmée par l'expérience. Bien que les sondages d'opinion eussent annoncé une majorité confortable en faveur de l'égalité des droits, on insista, en Suisse romande surtout, sur une forte participation au scrutin, car on ne tenait pour acquises ni la majorité des Etats ni celle du peuple. Le résultat du scrutin dépassa les espérances (621'109 oui contre 323'882 non, participation de 57,7 %; 6 1/2 cantons ont rejeté le projet: AR, AI, GL, OW, SG, SZ, TG, UR). La participation fut relativement élevée, seul le Tessin demeura en dessous de 50 %. Les partisans représentèrent presque une majorité des deux tiers. Le projet fut admis non seulement par les neuf cantons qui avaient déjà introduit le suffrage féminin en matière cantonale, mais encore par trois cantons et demi sur les quatre qui l'exerçaient à titre obligatoire ou facultatif en matière communale, et en plus par trois autres cantons qui n'avaient encore reconnu à la femme aucune égalité politique. Les plus fortes majorités acceptantes furent enregistrées en Suisse romande et au Tessin, ainsi que dans les grandes agglomérations urbaines de la Suisse alémanique; la majorité des cantons de Suisse centrale et de Suisse orientale constituèrent un bloc assez compact d'opposants.


Votation du 7 février 1971

participation: 57.73%
Oui: 65.73% / états : 15.5
Non: 34.3% / états : 6.5

Paroles:
Oui: CVP, EVP, FDP, LdU, LPS, PdA, SPS, SVP, SAV, SGB, TravS, VSA
Non: quelques cas locaux

L'introduction du suffrage féminin (MCF 10476)